Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 7/FGF-7/KGF

Source: E. coli. MW :19.1kD. Recombinant Human Fibroblast Growth Factor 7 is produced by our E.coli expression system and the target gene encoding Cys32-Thr194 is expressed. Fibroblast growth factor 7 (FGF7) is a secreted protein which is mainly located in epithelial cells and belongs to the heparin-binding growth factors family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. It is possible major paracrine effector of normal epithelial cell proliferation.

Product Specifications

Gene Name

FGF7

Gene ID

2252

UniProt

P21781

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH8.0, l50mM NaCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MEK 162
TRC-M208300-10MG 10 mg

MEK 162

Ask
View Details
ATG13 Rabbit pAb
RA22185-01 50 µL

ATG13 Rabbit pAb

Ask
View Details
ATG13 Rabbit pAb
RA22185-02 100 µL

ATG13 Rabbit pAb

Ask
View Details
7-chloro-2-phenyl-2H-pyrazolo[3,4-d]pyridazine
sc-357277 1 g

7-chloro-2-phenyl-2H-pyrazolo[3,4-d]pyridazine

Ask
View Details
Mouse Monoclonal Cytochrome P450 3A4 3A5 Antibody (F24P2B10) [DyLight 405]
NBP2-50208V 0.1 mL

Mouse Monoclonal Cytochrome P450 3A4 3A5 Antibody (F24P2B10) [DyLight 405]

Ask
View Details
Valine--tRNA ligase, mitochondrial (VARS2) Antibody
abx346562-01 20 µg

Valine--tRNA ligase, mitochondrial (VARS2) Antibody

Ask
View Details