Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sonic Hedgehog/SHH

Source: E.coli. MW :19.8kD. Recombinant Mouse Sonic Hedgehog is produced by our E.coli expression system and the target gene encoding Cys25-Gly198 is expressed. Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH) . Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa N­terminal fragment (Shh­N), and a catalytic­processing, glycosylated, 34 kDa, 239 aa C­terminal fragment. The 20 kDa Shh­N fragment is the core of the active hedgehog molecule. Mouse Shh­N is 99%, 98%, and 100% aa identical to human, rat and gerbil Shh­N, respectively.

Product Specifications

Gene Name

Shh

Gene ID

20423

UniProt

Q62226

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jph1 Rat shRNA Plasmid (Locus ID 297748)
TR705207 1 Kit

Jph1 Rat shRNA Plasmid (Locus ID 297748)

Sign In for Pricing
View Details
Thyroid peroxidase Polyclonal Antibody, Cy5 Conjugated
bs-10406R-Cy5-01 20 µL

Thyroid peroxidase Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Thyroid peroxidase Polyclonal Antibody, Cy5 Conjugated
bs-10406R-Cy5-02 100 µL

Thyroid peroxidase Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
STX3 ORF Vector (Human) (pORF)
ORF010177 1.0 µg DNA

STX3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RalA Binding Protein 1 (RALBP1) Polyclonal Antibody
CAU22020-01 100 µL

RalA Binding Protein 1 (RALBP1) Polyclonal Antibody

Sign In for Pricing
View Details
RalA Binding Protein 1 (RALBP1) Polyclonal Antibody
CAU22020-02 200 µL

RalA Binding Protein 1 (RALBP1) Polyclonal Antibody

Sign In for Pricing
View Details