Recombinant Mouse S100 Calcium Binding Protein A8/S100A8 (C-6His)
Source: E. coli. MW :11.3kD. Recombinant Mouse S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu89 is expressed with a 6His tag at the C-terminus. Protein S100-A8 (Mrp8) contains 2 EF-hand domains and belongs to the S-100 family. Mrp8 binds two calcium ions per molecule with an affinity similar to that of the S-100 proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. It may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.
Product Specifications
Gene Name
S100a8
Gene ID
20201
UniProt
P27005
Components
Lyophilized from a 0.2 μm filtered solution of 20mMTris, pH8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKELEHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog