Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High Mobility Group Protein B1/HMGB1 (N-MARI)

Source: E. coli. MW :10kD. Recombinant Human High mobility group protein B1 is produced by our E.coli expression system and the target gene encoding Pro92-Val176 is expressed with a MARI tag at the N-terminus. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Product Specifications

Gene Name

HMGB1

Gene ID

3146

UniProt

P09429

Components

Lyophilized from a 0.2 μm filtered solution of 50mM HEPES-Na, p H 7.9,500mM NaCl,0.6mM DTT.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MARIDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDE4B3 Peptide
MBS544201-01 0.25 mg

PDE4B3 Peptide

Ask
View Details
PDE4B3 Peptide
MBS544201-02 5x 0.25 mg

PDE4B3 Peptide

Ask
View Details
Mouse Monoclonal CD164 Antibody (67D2) [Janelia Fluor 549]
NBP2-75970JF549 0.1 mL

Mouse Monoclonal CD164 Antibody (67D2) [Janelia Fluor 549]

Ask
View Details
PCMV-3xMyc-RAB11B-Neo Plasmid
PVT74421 2 µg

PCMV-3xMyc-RAB11B-Neo Plasmid

Ask
View Details
PLV3-U6-KLF2-shRNA2-mCherry-Puro Plasmid
PVT73911 2 µg

PLV3-U6-KLF2-shRNA2-mCherry-Puro Plasmid

Ask
View Details
ASS1 Knockout Cell Lysate
ABC-KC0133 100 µg

ASS1 Knockout Cell Lysate

Ask
View Details