Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS (C-6His)

Source: E. coli. MW :24.3kD. Recombinant Human Methenyl-THF synthetase is produced by our E.coli expression system and the target gene encoding Met1-Ala203 is expressed with a 6His tag at the C-terminus. 5-formyltetrahydrofolate cyclo-ligase (MTHFS) belongs to the 5-formyltetrahydrofolate cyclo-ligase family. It is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, contributes to tetrahydrofolate metabolism. MTHFS helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion.

Product Specifications

Gene Name

MTHFS

Gene ID

10588

UniProt

P49914

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTALEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C3AR1 Knockout A549 cell line
GTR15407281 1 Vial

Human C3AR1 Knockout A549 cell line

Sign In for Pricing
View Details
FtsZ (Biotin)
563066-01 50 µg

FtsZ (Biotin)

Sign In for Pricing
View Details
FtsZ (Biotin)
563066-02 100 µg

FtsZ (Biotin)

Sign In for Pricing
View Details
Anti- M-Calpain N-Terminal Antibody
GWB-B7CC86 0.1 mg

Anti- M-Calpain N-Terminal Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Sordellii plc Protein (aa 29-399)
VAng-Lsx01505-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Sordellii plc Protein (aa 29-399)

Sign In for Pricing
View Details
Serpina3m ORF Vector (Mouse) (pORF)
43457014 1.0 µg DNA

Serpina3m ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details