Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS (C-6His)

Source: E. coli. MW :24.3kD. Recombinant Human Methenyl-THF synthetase is produced by our E.coli expression system and the target gene encoding Met1-Ala203 is expressed with a 6His tag at the C-terminus. 5-formyltetrahydrofolate cyclo-ligase (MTHFS) belongs to the 5-formyltetrahydrofolate cyclo-ligase family. It is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, contributes to tetrahydrofolate metabolism. MTHFS helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion.

Product Specifications

Gene Name

MTHFS

Gene ID

10588

UniProt

P49914

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTALEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

JMJD2A antibody
10R-1509 100 ug

JMJD2A antibody

Ask
View Details
HOXC4 (Homeobox C4, HOX3, HOX3E, cp19) (MaxLight 550)
247234-ML550 100 µL

HOXC4 (Homeobox C4, HOX3, HOX3E, cp19) (MaxLight 550)

Ask
View Details
anti-BRG1
YF-PA24728 50 ul

anti-BRG1

Ask
View Details
Recombinant Dromaius novaehollandiae Cytochrome c oxidase subunit 1 (MT-CO1), partial
MBS1205891-01 1 mg (E-Coli)

Recombinant Dromaius novaehollandiae Cytochrome c oxidase subunit 1 (MT-CO1), partial

Ask
View Details
Recombinant Dromaius novaehollandiae Cytochrome c oxidase subunit 1 (MT-CO1), partial
MBS1205891-02 1 mg (Yeast)

Recombinant Dromaius novaehollandiae Cytochrome c oxidase subunit 1 (MT-CO1), partial

Ask
View Details
ZNF548 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51602151 3x 1.0 µg DNA

ZNF548 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details