Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS (C-6His)

Source: E. coli. MW :24.3kD. Recombinant Human Methenyl-THF synthetase is produced by our E.coli expression system and the target gene encoding Met1-Ala203 is expressed with a 6His tag at the C-terminus. 5-formyltetrahydrofolate cyclo-ligase (MTHFS) belongs to the 5-formyltetrahydrofolate cyclo-ligase family. It is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, contributes to tetrahydrofolate metabolism. MTHFS helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion.

Product Specifications

Gene Name

MTHFS

Gene ID

10588

UniProt

P49914

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTALEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human USP3 Protein, N-His
YHK67101 100 μg

Recombinant Human USP3 Protein, N-His

Ask
View Details
Thrombin R, cleaved (S42)
311213-01 50 µg

Thrombin R, cleaved (S42)

Ask
View Details
Thrombin R, cleaved (S42)
311213-02 100 µg

Thrombin R, cleaved (S42)

Ask
View Details
ANXA1 Mouse
PT-A00233-01 5 µg

ANXA1 Mouse

Ask
View Details
ANXA1 Mouse
PT-A00233-02 20 µg

ANXA1 Mouse

Ask
View Details
ANXA1 Mouse
PT-A00233-03 1 mg

ANXA1 Mouse

Ask
View Details