Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)

Source: E. coli. MW :27.3kD. Recombinant Human FKBP25/ is produced by our E.coli expression system and the target gene encoding Met1-Asp224 is expressed with a 6His tag at the N-terminus. FKBP3 contains 1 PPIase FKBP-type domain, belongs to the FKBP-type PPIase family. FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. FKBP3 is a cis-trans prolyl isomerase enzyme that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Product Specifications

Gene Name

FKBP3

Gene ID

2287

UniProt

Q00688

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,1mM DTT,10% glycerol .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhb12 Mouse qPCR Primer Pair (NM_053137)
MP212141 200 Reactions

Pcdhb12 Mouse qPCR Primer Pair (NM_053137)

Sign In for Pricing
View Details
Carbonic Anhydrase XII (CA12) Antibody (HRP)
abx108045-01 20 µg

Carbonic Anhydrase XII (CA12) Antibody (HRP)

Sign In for Pricing
View Details
Carbonic Anhydrase XII (CA12) Antibody (HRP)
abx108045-02 50 µg

Carbonic Anhydrase XII (CA12) Antibody (HRP)

Sign In for Pricing
View Details
Carbonic Anhydrase XII (CA12) Antibody (HRP)
abx108045-03 100 µg

Carbonic Anhydrase XII (CA12) Antibody (HRP)

Sign In for Pricing
View Details
Carbonic Anhydrase XII (CA12) Antibody (HRP)
abx108045-04 200 µg

Carbonic Anhydrase XII (CA12) Antibody (HRP)

Sign In for Pricing
View Details
Carbonic Anhydrase XII (CA12) Antibody (HRP)
abx108045-05 1 mg

Carbonic Anhydrase XII (CA12) Antibody (HRP)

Sign In for Pricing
View Details