Recombinant Human Transcriptional Repressor Protein YY1 (C-6His)
Source: E. coli. MW :12.6kD. Recombinant Human Yin and Yang 1 protein is produced by our E.coli expression system and the target gene encoding Val221-Gly321 is expressed with a 6His tag at the C-terminus. Transcriptional repressor protein YY1 (YY1) contains 4 C2H2-type zinc fingers and belongs to the YY transcription factor family. Multifunctional transcription factor exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. The effect on transcription regulation of the protein is depending upon the context in which it binds and diverse mechanisms of action include direct activation or repression, indirect activation or repression via cofactor recruitment, or activation or repression by disruption of binding sites or conformational DNA changes. Its activity is regulated by transcription factors and cytoplasmic proteins that have been shown to abrogate or completely inhibit YY1-mediated activation or repression.
Product Specifications
Gene Name
YY1
Gene ID
7528
UniProt
P25490
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog