Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional Repressor Protein YY1 (C-6His)

Source: E. coli. MW :12.6kD. Recombinant Human Yin and Yang 1 protein is produced by our E.coli expression system and the target gene encoding Val221-Gly321 is expressed with a 6His tag at the C-terminus. Transcriptional repressor protein YY1 (YY1) contains 4 C2H2-type zinc fingers and belongs to the YY transcription factor family. Multifunctional transcription factor exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. The effect on transcription regulation of the protein is depending upon the context in which it binds and diverse mechanisms of action include direct activation or repression, indirect activation or repression via cofactor recruitment, or activation or repression by disruption of binding sites or conformational DNA changes. Its activity is regulated by transcription factors and cytoplasmic proteins that have been shown to abrogate or completely inhibit YY1-mediated activation or repression.

Product Specifications

Gene Name

YY1

Gene ID

7528

UniProt

P25490

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human SLC24A4 pAb
PA10808-01 50 μL

Rabbit Anti-Human SLC24A4 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SLC24A4 pAb
PA10808-02 100 μL

Rabbit Anti-Human SLC24A4 pAb

Sign In for Pricing
View Details
VWA5A Antibody
MBS9403567-01 0.1 mL

VWA5A Antibody

Sign In for Pricing
View Details
VWA5A Antibody
MBS9403567-02 5x 0.1 mL

VWA5A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal RUNX1T1/ETO Antibody (OTI1H1) [Alexa Fluor 750]
NBP2-73956AF750 0.1 mL

Mouse Monoclonal RUNX1T1/ETO Antibody (OTI1H1) [Alexa Fluor 750]

Sign In for Pricing
View Details
Integrin alpha E (ITGAE) (NM_002208) Human 3' UTR Clone
SC202887 10 µg

Integrin alpha E (ITGAE) (NM_002208) Human 3' UTR Clone

Sign In for Pricing
View Details