Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1/PRDX1 (N, C-6His)

Source: E. coli. MW :25.3kD. Recombinant Human Peroxiredoxin-1 is produced by our E.coli expression system and the target gene encoding Met1-Lys199 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Peroxiredoxin-1 (PRDX1) contains 1 thioredoxin domain and belongs to the AhpC/TSA family. PRDX1 constitutively expressed in most human cells and it is induced to higher levels upon serum stimulation in untransformed and transformed cells. PRDX1 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin and play an important role in eliminating peroxides generated during metabolism. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. It may contribute to the antiviral activity of CD8 (+) T-cells and have a proliferative effect in cancer development or progression.

Product Specifications

Gene Name

PRDX1

Gene ID

5052

UniProt

Q06830

Components

Supplied as a 0.2 μm filtered solution of PBS, 10% glycerol, 0.1mM DTT, pH 6.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CTBP2 (NM_001083914) Human Tagged ORF Clone
RC213339 10 µg

CTBP2 (NM_001083914) Human Tagged ORF Clone

Ask
View Details
Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein
abx653220-01 10 µg

Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein

Ask
View Details
Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein
abx653220-02 50 µg

Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein

Ask
View Details
Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein
abx653220-03 100 µg

Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein

Ask
View Details
Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein
abx653220-04 200 µg

Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein

Ask
View Details
Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein
abx653220-05 500 µg

Mouse Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) Protein

Ask
View Details