Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1/UBE2D1/UbcH5a (N-GST)

Source: E. coli. MW :42.9kD. Recombinant Human Ubiquitin-conjugating enzyme E2 D1 is produced by our E.coli expression system and the target gene encoding Met1-Met147 is expressed with a GST tag at the N-terminus. Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) belongs to the ubiquitin-conjugating enzyme family. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Product Specifications

Gene Name

UBE2D1

Gene ID

7321

UniProt

P51668

Components

Lyophilized from a 0.2 μm filtered solution of 50mM HEPES,150mM NaCl,2mM DTT,10% Glycerin pH7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PUM2 Antibody [Biotin]
NB100-387B 0.1 mL

Rabbit Polyclonal PUM2 Antibody [Biotin]

Sign In for Pricing
View Details
Amenamevir
TRC-A576425-500MG 500 mg

Amenamevir

Sign In for Pricing
View Details
10x PCR Buffer without MgCl2
ABP-PP-ERBF005 5x1ml

10x PCR Buffer without MgCl2

Sign In for Pricing
View Details
TRIM42 Protein Lysate (Human) with C-Ha Tag
47785031 100 µg

TRIM42 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Carbonic-Anhydrase-IX-LumiAb ELISA Kit
Lum-8305 1 Kit

Carbonic-Anhydrase-IX-LumiAb ELISA Kit

Sign In for Pricing
View Details
C1orf105 (NM_139240) Human Tagged Lenti ORF Clone
RC206714L3 10 µg

C1orf105 (NM_139240) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details