Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Krueppel-Like Factor 6/KLF6

Source: E. coli. MW :12.6kD. Recombinant Human Krueppel-like factor 6 is produced by our E.coli expression system and the target gene encoding Met1-Ser109 is expressed. Krueppel-Like Factor 6 (KLF6) belongs to the krueppel C2H2-type zinc-finger protein family. KLF6 contains three C2H2-type zinc fingers and localizes in the nucleus. KLF6 expression is highest in the placenta followed by spleen, thymus, prostate, testis, small intestinem and colon. However, it is weakly expressed in the pancreas, lung, liver, heart, and skeletal muscle. KLF6 functions as a transcriptional activator and could play a role in B-cell growth and development. Defects in KLF6 will result in gastric cancer and prostate cancer.

Product Specifications

Gene Name

KLF6

Gene ID

1316

UniProt

Q99612

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Stk38 Antibody (C-term) Blocking Peptide
MBS9224091-01 0.5 mg

Mouse Stk38 Antibody (C-term) Blocking Peptide

Ask
View Details
Mouse Stk38 Antibody (C-term) Blocking Peptide
MBS9224091-02 5x 0.5 mg

Mouse Stk38 Antibody (C-term) Blocking Peptide

Ask
View Details
C17orf59 Overexpression Lysate (Native) - (Dry Ice)
NBP2-10228 0.1 mg

C17orf59 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Anti-GUCY1A1 Antibody (R2C10)
RHF91701 100 μg

Anti-GUCY1A1 Antibody (R2C10)

Ask
View Details
LY-2584702 (hydrochloride)
HY-12493B 1 Each

LY-2584702 (hydrochloride)

Ask
View Details
Steap2 Rat siRNA Oligo Duplex (Locus ID 312052)
SR502924 1 Kit

Steap2 Rat siRNA Oligo Duplex (Locus ID 312052)

Ask
View Details