Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Krueppel-Like Factor 6/KLF6

Source: E. coli. MW :12.6kD. Recombinant Human Krueppel-like factor 6 is produced by our E.coli expression system and the target gene encoding Met1-Ser109 is expressed. Krueppel-Like Factor 6 (KLF6) belongs to the krueppel C2H2-type zinc-finger protein family. KLF6 contains three C2H2-type zinc fingers and localizes in the nucleus. KLF6 expression is highest in the placenta followed by spleen, thymus, prostate, testis, small intestinem and colon. However, it is weakly expressed in the pancreas, lung, liver, heart, and skeletal muscle. KLF6 functions as a transcriptional activator and could play a role in B-cell growth and development. Defects in KLF6 will result in gastric cancer and prostate cancer.

Product Specifications

Gene Name

KLF6

Gene ID

1316

UniProt

Q99612

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTTNBP2NL (N-term) Rabbit Polyclonal Antibody
AP51136PU-N 400 µL

CTTNBP2NL (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS620100 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
ACSL1 (NM_001995) Human Over-expression Lysate
LC419599 20 µg

ACSL1 (NM_001995) Human Over-expression Lysate

Sign In for Pricing
View Details
HOXC11 Rabbit Polyclonal Antibody
TA367670 100 µL

HOXC11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF454 activation kit by CRISPRa
GA117251 1 Kit

Human ZNF454 activation kit by CRISPRa

Sign In for Pricing
View Details
IRF2BP1 Mouse Monoclonal Antibody [Clone ID: OTI5H7]
CF811721 100 µg

IRF2BP1 Mouse Monoclonal Antibody [Clone ID: OTI5H7]

Sign In for Pricing
View Details