Recombinant Human Krueppel-Like Factor 6/KLF6
Source: E. coli. MW :12.6kD. Recombinant Human Krueppel-like factor 6 is produced by our E.coli expression system and the target gene encoding Met1-Ser109 is expressed. Krueppel-Like Factor 6 (KLF6) belongs to the krueppel C2H2-type zinc-finger protein family. KLF6 contains three C2H2-type zinc fingers and localizes in the nucleus. KLF6 expression is highest in the placenta followed by spleen, thymus, prostate, testis, small intestinem and colon. However, it is weakly expressed in the pancreas, lung, liver, heart, and skeletal muscle. KLF6 functions as a transcriptional activator and could play a role in B-cell growth and development. Defects in KLF6 will result in gastric cancer and prostate cancer.
Product Specifications
Gene Name
KLF6
Gene ID
1316
UniProt
Q99612
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items