Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-22/IL-22

Source: E. coli. MW :16.9kD. Recombinant Human Interleukin-22 is produced by our E.coli expression system and the target gene encoding Ala34-Ile179 is expressed. Interleukin-22 (IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.

Product Specifications

Gene Name

IL22

Gene ID

50616

UniProt

Q9GZX6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat 8-isoprostane ELISA Kit
MBS2614854-01 48 Well

Goat 8-isoprostane ELISA Kit

Ask
View Details
Goat 8-isoprostane ELISA Kit
MBS2614854-02 96 Well

Goat 8-isoprostane ELISA Kit

Ask
View Details
Goat 8-isoprostane ELISA Kit
MBS2614854-03 5x 96 Well

Goat 8-isoprostane ELISA Kit

Ask
View Details
Goat 8-isoprostane ELISA Kit
MBS2614854-04 10x 96 Well

Goat 8-isoprostane ELISA Kit

Ask
View Details
Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (FITC)
MBS6359774-01 0.2 mL

Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (FITC)

Ask
View Details
Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (FITC)
MBS6359774-02 5x 0.2 mL

Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (FITC)

Ask
View Details