Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA (N-6His)

Source: E. coli. MW :15.9kD. Recombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-Thr211 is expressed with a 6His tag at the N-terminus. Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Product Specifications

Gene Name

PDGFA

Gene ID

5154

UniProt

P04085

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RGS7 Antibody
E55A14688 100 µg

RGS7 Antibody

Ask
View Details
Anti-IL6 (Clazakizumab)-MC-Vc-PAB-MMAE ADC
ADC-W-1415 1 mg

Anti-IL6 (Clazakizumab)-MC-Vc-PAB-MMAE ADC

Ask
View Details
Tissue Genomic DNA, Colon
CD563401 5 µg

Tissue Genomic DNA, Colon

Ask
View Details
Recombinant Human ACTA2 protein (His tag)
MBS2580549-01 0.02 mg

Recombinant Human ACTA2 protein (His tag)

Ask
View Details
Recombinant Human ACTA2 protein (His tag)
MBS2580549-02 0.1 mg

Recombinant Human ACTA2 protein (His tag)

Ask
View Details
Recombinant Human ACTA2 protein (His tag)
MBS2580549-03 5x 0.1 mg

Recombinant Human ACTA2 protein (His tag)

Ask
View Details