Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuritin/NRN1 (N-6His)

Source: E. coli. MW :12.1kD. Recombinant Human Neuritin is produced by our E.coli expression system and the target gene encoding Ala28-Gly116 is expressed with a 6His tag at the N-terminus. Neuritin/NRN1 is a member of the neuritin family and can be expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. Neuritin/NRN1 promotes neurite outgrowt, arborization and neuritogenesis. The protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI) -anchored proteins.Overexpression of the encoded protein may be associated with astrocytoma progression.

Product Specifications

Gene Name

NRN1

Gene ID

51299

UniProt

Q9NPD7

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse DDR1 Kinase / MCK10 / CD167 Protein (His tag)
E53A08071 50 µg

Recombinant Mouse DDR1 Kinase / MCK10 / CD167 Protein (His tag)

Ask
View Details
N-Desethyl Acetildenafil
008288 2.5 mg

N-Desethyl Acetildenafil

Ask
View Details
RN5S285 Adenovirus (Human)
39857051 1.0 mL

RN5S285 Adenovirus (Human)

Ask
View Details
Rat Phoenixin-14,PNX-14 ELISA KIT
JOT-EK3337Ra 96 wells

Rat Phoenixin-14,PNX-14 ELISA KIT

Ask
View Details
Anti-S100P Antibody (Biotin)
STJ502851 100 µg

Anti-S100P Antibody (Biotin)

Ask
View Details