Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuritin/NRN1 (N-6His)

Source: E. coli. MW :12.1kD. Recombinant Human Neuritin is produced by our E.coli expression system and the target gene encoding Ala28-Gly116 is expressed with a 6His tag at the N-terminus. Neuritin/NRN1 is a member of the neuritin family and can be expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. Neuritin/NRN1 promotes neurite outgrowt, arborization and neuritogenesis. The protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI) -anchored proteins.Overexpression of the encoded protein may be associated with astrocytoma progression.

Product Specifications

Gene Name

NRN1

Gene ID

51299

UniProt

Q9NPD7

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TK1 (Thymidine Kinase, Cytosolic) (HRP)
MBS6396603-01 0.1 mL

TK1 (Thymidine Kinase, Cytosolic) (HRP)

Ask
View Details
TK1 (Thymidine Kinase, Cytosolic) (HRP)
MBS6396603-02 5x 0.1 mL

TK1 (Thymidine Kinase, Cytosolic) (HRP)

Ask
View Details
TLE6 AAV siRNA Pooled Vector
46760161 1.0 µg

TLE6 AAV siRNA Pooled Vector

Ask
View Details
Mouse Interleukin-1 beta (IL-1 beta) AssayLite™ Antibody (PerCP Conjugate)
33010-05171 5x 30 µg

Mouse Interleukin-1 beta (IL-1 beta) AssayLite™ Antibody (PerCP Conjugate)

Ask
View Details
Lentiviral human TSPO shRNA (UAS) - Lentiviral human TSPO shRNA (UAS) (100)
GTR15109458 1 Vial

Lentiviral human TSPO shRNA (UAS) - Lentiviral human TSPO shRNA (UAS) (100)

Ask
View Details
Anti-CD47/MER6 (sB24M) Biosimilar (Monoclonal, IgG)
A135918 100 µL

Anti-CD47/MER6 (sB24M) Biosimilar (Monoclonal, IgG)

Ask
View Details