Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM19A4/FAM19A4 (N-6His)

Source: E. coli. MW :14.1kD. Recombinant Human FAM19A44 is produced by our E.coli expression system and the target gene encoding Ser35-Arg140 is expressed with a 6His tag at the N-terminus. FAM19A4 is a secreted, 12 kDa member of the FAM19/TAFA family of chemokine-like proteins. Like other members of the FAM19/TAFA family, with the exception of TAFA5, mature FAM19A4 contains 10 regularly spaced cysteine residues. The FAM19A4 proteins are predominantly expressed in specific regions of the brain and the biological functions of FAM19A4 family members remain to be determined, but there are a few tentative hypotheses. First, FAM19A4 may modulate immune responses in the CNS by functioning as brain specific chemokines, and may act with other chemokines to optimize the recruitment and activity of immune cells in the CNS. Second, FAM19A4 may represent a novel class of neurokines that act as regulators of immune nervous cells. And third, FAM19A4 may control axonal sprouting following brain injury.

Product Specifications

Gene Name

FAM19A4

Gene ID

151647

UniProt

Q96LR4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit haemorrhagic disease virus, RHDV ELISA KIT
ED0020Rb-01 96 Well

Rabbit haemorrhagic disease virus, RHDV ELISA KIT

Ask
View Details
Rabbit haemorrhagic disease virus, RHDV ELISA KIT
ED0020Rb-02 5x 96 Tests

Rabbit haemorrhagic disease virus, RHDV ELISA KIT

Ask
View Details
Rabbit haemorrhagic disease virus, RHDV ELISA KIT
ED0020Rb-03 10x 96 Tests

Rabbit haemorrhagic disease virus, RHDV ELISA KIT

Ask
View Details
Brilliant Violet 785™ anti-human CD14
GT07171 25 Tests

Brilliant Violet 785™ anti-human CD14

Ask
View Details
Rabbit Anti-Human GBA2 pAb
PA6469-01 50 μL

Rabbit Anti-Human GBA2 pAb

Ask
View Details
Rabbit Anti-Human GBA2 pAb
PA6469-02 100 μL

Rabbit Anti-Human GBA2 pAb

Ask
View Details