Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Repulsive Guidance Molecule A/RGMA (N-6His)

Source: E. coli. MW :29.8kD. Recombinant Human Repulsive guidance molecule A is produced by our E.coli expression system and the target gene encoding Pro169-Gly422 is expressed with a 6His tag at the N-terminus. Repulsive guidance molecule A (RGMA) is a cell membrane protein and belongs to the repulsive guidance molecule (RGM) family. It interacts with NEO1, BMP2 and BMP4. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. It helps guide Retinal Ganglion Cell (RGC) axons to the tectum in the midbrain. RGMa has been implicated to play an important role in the developing brain and in the scar tissue that forms after a brain injury. This protein may also function as a tumor suppressor in some cancers.

Product Specifications

Gene Name

RGMA

Gene ID

56963

UniProt

Q96B86

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPG
More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A Matrix Protein Antibody
GWB-E5BB6E 1 mg

Influenza A Matrix Protein Antibody

Sign In for Pricing
View Details
Proliferating Synoviocytes, Rheumatoid Arthritis (HFLS-RA), adult
409RA-25a T-25 Flask

Proliferating Synoviocytes, Rheumatoid Arthritis (HFLS-RA), adult

Sign In for Pricing
View Details
Cat Putative Tyrosine-Protein Phosphatase TPTE (TPTE) ELISA Kit
MBS9931464 Inquire

Cat Putative Tyrosine-Protein Phosphatase TPTE (TPTE) ELISA Kit

Sign In for Pricing
View Details
Recombinant PTP1B Antibody
RC-15513-01 50 μL

Recombinant PTP1B Antibody

Sign In for Pricing
View Details
Recombinant PTP1B Antibody
RC-15513-02 100 µL

Recombinant PTP1B Antibody

Sign In for Pricing
View Details
Recombinant PTP1B Antibody
RC-15513-03 1 mL

Recombinant PTP1B Antibody

Sign In for Pricing
View Details