Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Repulsive Guidance Molecule A/RGMA (N-6His)

Source: E. coli. MW :29.8kD. Recombinant Human Repulsive guidance molecule A is produced by our E.coli expression system and the target gene encoding Pro169-Gly422 is expressed with a 6His tag at the N-terminus. Repulsive guidance molecule A (RGMA) is a cell membrane protein and belongs to the repulsive guidance molecule (RGM) family. It interacts with NEO1, BMP2 and BMP4. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. It helps guide Retinal Ganglion Cell (RGC) axons to the tectum in the midbrain. RGMa has been implicated to play an important role in the developing brain and in the scar tissue that forms after a brain injury. This protein may also function as a tumor suppressor in some cancers.

Product Specifications

Gene Name

RGMA

Gene ID

56963

UniProt

Q96B86

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPG
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ALK Antibody
E30AC1316 100 µL

ALK Antibody

Ask
View Details
RGP1 Rabbit Polyclonal Antibody
TA338320 100 µL

RGP1 Rabbit Polyclonal Antibody

Ask
View Details
Ouabain Antibody
abx405157-01 100 µL

Ouabain Antibody

Ask
View Details
Ouabain Antibody
abx405157-02 200 µL

Ouabain Antibody

Ask
View Details
Ouabain Antibody
abx405157-03 1 mL

Ouabain Antibody

Ask
View Details
P70 S6 Kinase, phosphorylated (Ser411)
526655-01 100 µL

P70 S6 Kinase, phosphorylated (Ser411)

Ask
View Details