Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Omentin/Intelectin-1/ITLN-1 (N-6His)

Source: E. coli. MW :32.7kD. Recombinant Human Intelectin-1 is produced by our E.coli expression system and the target gene encoding Thr19-Ser298 is expressed with a 6His tag at the N-terminus. Intelectin-1 (ITLN1) is a secreted protein and contains 1 fibrinogen C-terminal domain. Intelectin-1 is a 40 kDa Ca-dependent galactofuranose-binding lectin that is not a C-type lectin. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. The protein has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. It increases AKT phosphorylation in the absence and presence of insulin and it may play a role in the defense systemagainst microorganisms. It also may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosy l residues, in a calcium-dependent manner.

Product Specifications

Gene Name

ITLN1

Gene ID

55600

UniProt

Q8WWA0

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Tris,100mMNaCl, 5mM GSH, 0.5mM GSSG, pH8.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Antibody to CK5
MBS8527734-01 0.1 mL

Mouse Monoclonal Antibody to CK5

Ask
View Details
Mouse Monoclonal Antibody to CK5
MBS8527734-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to CK5

Ask
View Details
Mouse Monoclonal Antibody to CK5
MBS8527734-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to CK5

Ask
View Details
Mouse Monoclonal Antibody to CK5
MBS8527734-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to CK5

Ask
View Details
Mouse Monoclonal Antibody to CK5
MBS8527734-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to CK5

Ask
View Details
Mouse Monoclonal Antibody to CK5
MBS8527734-06 0.1 mL (APC)

Mouse Monoclonal Antibody to CK5

Ask
View Details