Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage Migration Inhibitory Factor/MIF

Source: E. coli. MW :12.5kD. Recombinant Human Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Met1-Ala115 is expressed. Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without asignal sequence .Secretion occurs nonclassically via an ABCA1 transporter.Pro-inflammatory cytokine.Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites ofinflammation suggests a role as mediator in regulating the function of acrophages in host defense.Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase anddopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clearwhether the tautomerase activity has any physiological relevance, and whether it is important for cytokineactivity.

Product Specifications

Gene Name

MIF

Gene ID

4282

UniProt

P14174

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aceroside VII
T126491-01 1 mg

Aceroside VII

Sign In for Pricing
View Details
Aceroside VII
T126491-02 5 mg

Aceroside VII

Sign In for Pricing
View Details
Rabbit Anti Human Antithrombin III Polyclonal Fractionated HRP Labeled 1mg
IRBAHUATIIIGFHRP1MG 1 mg

Rabbit Anti Human Antithrombin III Polyclonal Fractionated HRP Labeled 1mg

Sign In for Pricing
View Details
KPNA3 Antibody Blocking peptide
orb1447563 500 µg

KPNA3 Antibody Blocking peptide

Sign In for Pricing
View Details
Fahd1 Mouse shRNA Plasmid (Locus ID 68636)
TR504183 1 Kit

Fahd1 Mouse shRNA Plasmid (Locus ID 68636)

Sign In for Pricing
View Details
TNFRSF10A, CT (TNFRSF10A, APO2, DR4, TRAILR1, Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, CD261) (Azide free) (HRP) discontinued
043069-HRP 200 µL

TNFRSF10A, CT (TNFRSF10A, APO2, DR4, TRAILR1, Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, CD261) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details