Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GABA (A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc)

Source: E. coli. MW :43.2kD. Recombinant Human GABARAP is produced by our E.coli expression system and the target gene encoding Met1-Gln116 is expressed with a 6His tag at the N-terminus, Fc tag at the C-terminus. Gamma-Aminobutyric Acid Receptor-Associated Protein (GABARAP) is a ligand-gated chloride channel protein that mediates inhibitory neurotransmission and belongs to the MAP1 LC3 family. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. Autophagy is the process by which cells recycle cytoplasm and dispose of excess or defective organelles. This process is suggested to be involved development, differentiation, growth regulation and tissue remodeling in multicellular organisms. An important inhibitory neurotransmitter, GABA, acts on GABA receptors that are ubiquitously expressed in the CNS. GABARAP has been shown to play a important role in intracellular transport of GABA (A) receptors and its interaction with the cytoskeleton.

Product Specifications

Gene Name

GABARAP

Gene ID

11337

UniProt

Q6IAW1

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,20% glycerol, pH7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CDH11 Antibody, HRP conjugated
A16777-100UG 100 µg

CDH11 Antibody, HRP conjugated

Ask
View Details
Mouse Pop4 Pre-designed siRNA Set A
SI110921A 1 Each

Mouse Pop4 Pre-designed siRNA Set A

Ask
View Details
Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2), partial
MBS7080750 Inquire

Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2), partial

Ask
View Details
BCL2 Antibody
MBS2516858-01 0.06 mL

BCL2 Antibody

Ask
View Details
BCL2 Antibody
MBS2516858-02 0.12 mL

BCL2 Antibody

Ask
View Details
BCL2 Antibody
MBS2516858-03 0.2 mL

BCL2 Antibody

Ask
View Details