Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, E. coli)

Source: E. coli. MW :21.8kD. Recombinant Human NGAL is produced by our E.coli expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus. Neutrophil gelatinase-associated lipocalin (LCN2) is a secreted protein and belongs to the calycin superfamily. This protein is released from injured tubular cells after various damaging stimuli, is already known by nephrologists as one of the most promising biomarkers of incoming Acute Kidney Injury (AKI) . Recent evidence also suggests its role as a biomarker in a variety of other renal and non-renal conditions. Moreover, recent studies seem to suggest a potential involvement of this factor also in the genesis and progression of chronic kidney diseases. NGAL is the first known mammalian protein which specifically binds organic molecules called siderophores, which are high-affinity iron chelators. NGAL, first known as an antibacterial factor of natural immunity, and an acute phase protein, is currently one of the most interesting and enigmatic proteins involved in the process of tumor development. acting as an intracellular iron carrier and protecting MMP9 from proteolytic degradation, NGAL has a clear pro-tumoral effect, as has already been observed in different tumors (e.g. breast, stomach, oesophagus, brain) in humans. In thyroid carcinomas, NGAL is strongly induced by NF-kB, an important factor involved both in tumor growth and in the link between chronic inflammation and neoplastic development. Thus, Lipocalin-2 (LCN2/NGAL) has been implicated in a variety of processes including cell differentiation, proliferation, survival and morphogenesis.

Product Specifications

Gene Name

LCN2

Gene ID

3934

UniProt

P80188

Components

Supplied as a 0.2 μm filtered solution of PBS,50% glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SDC2 Mouse Monoclonal Antibody
AG3203 50 µL

SDC2 Mouse Monoclonal Antibody

Ask
View Details
TAF1A siRNA (Mouse)
CRM4008-01 15 nmol

TAF1A siRNA (Mouse)

Ask
View Details
TAF1A siRNA (Mouse)
CRM4008-02 30 nmol

TAF1A siRNA (Mouse)

Ask
View Details
Human FKBP9P1 (NM_182827) AAV Particle
RC204299A1V 250 µL

Human FKBP9P1 (NM_182827) AAV Particle

Ask
View Details
NF-kB p65 (RELA) Human shRNA Plasmid Kit (Locus ID 5970)
TF302038 1 Kit

NF-kB p65 (RELA) Human shRNA Plasmid Kit (Locus ID 5970)

Ask
View Details
POLR2C Antibody, FITC conjugated
A31597-100UG 100 µg

POLR2C Antibody, FITC conjugated

Ask
View Details