Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TMX2/TXNDC14 (N-6His)

Source: E. coli. MW :21.9kD. Recombinant Human TMX2 is produced by our E.coli expression system and the target gene encoding Met125-Lys296 is expressed with a 6His tag at the N-terminus. TMX2 is a single-pass type I membrane protein and contains 1 thioredoxin domain. Thioredoxin plays an important role in various cellular processes through redox regulation. The molecular cloning and characterization of one member of the thioredoxin superfamily, designated as TMX2.The TMX2 cDNA consists of 1644 nucleotides and contains an open reading frame encoding a protein of 372 amino acids with a predicted molecular mass of 42.5 kDa and an isoelectric point of 8.94. The TMX2 protein may possess an N-terminal signal peptide, a potential transmembrane domain, an Myb DNA-binding domain repeat signature, a thioredoxin consensus pattern, an endoplasmic reticulum (ER) membrane retention signal (KKXX-like motif), and a dileucine motif in the tail.

Product Specifications

Gene Name

TMX2

Gene ID

51075

UniProt

Q9Y320

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RBKS Antibody
NBP1-84115 0.1 mL

Rabbit Polyclonal RBKS Antibody

Sign In for Pricing
View Details
CXCR5 Rabbit Polyclonal Antibody
TA323128 100 µL

CXCR5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DAP Kinase 2 (DAPK2) Mouse Monoclonal Antibody [Clone ID: LBI1B5]
AMM09708V 100 µL

DAP Kinase 2 (DAPK2) Mouse Monoclonal Antibody [Clone ID: LBI1B5]

Sign In for Pricing
View Details
VAMP3, ID (VAMP3, SYB3, Vesicle-associated membrane protein 3, Cellubrevin, Synaptobrevin-3) (APC)
MBS6362181-01 0.2 mL

VAMP3, ID (VAMP3, SYB3, Vesicle-associated membrane protein 3, Cellubrevin, Synaptobrevin-3) (APC)

Sign In for Pricing
View Details
VAMP3, ID (VAMP3, SYB3, Vesicle-associated membrane protein 3, Cellubrevin, Synaptobrevin-3) (APC)
MBS6362181-02 5x 0.2 mL

VAMP3, ID (VAMP3, SYB3, Vesicle-associated membrane protein 3, Cellubrevin, Synaptobrevin-3) (APC)

Sign In for Pricing
View Details
Mouse Cadherin, Heart ELISA Kit
MBS095961-01 48 Well

Mouse Cadherin, Heart ELISA Kit

Sign In for Pricing
View Details