Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TMX2/TXNDC14 (N-6His)

Source: E. coli. MW :21.9kD. Recombinant Human TMX2 is produced by our E.coli expression system and the target gene encoding Met125-Lys296 is expressed with a 6His tag at the N-terminus. TMX2 is a single-pass type I membrane protein and contains 1 thioredoxin domain. Thioredoxin plays an important role in various cellular processes through redox regulation. The molecular cloning and characterization of one member of the thioredoxin superfamily, designated as TMX2.The TMX2 cDNA consists of 1644 nucleotides and contains an open reading frame encoding a protein of 372 amino acids with a predicted molecular mass of 42.5 kDa and an isoelectric point of 8.94. The TMX2 protein may possess an N-terminal signal peptide, a potential transmembrane domain, an Myb DNA-binding domain repeat signature, a thioredoxin consensus pattern, an endoplasmic reticulum (ER) membrane retention signal (KKXX-like motif), and a dileucine motif in the tail.

Product Specifications

Gene Name

TMX2

Gene ID

51075

UniProt

Q9Y320

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sucrose
CN-S011-500GM 500 g

Sucrose

Ask
View Details
Human GALE Protein, His Tag
KMPH6437-01 20 µg

Human GALE Protein, His Tag

Ask
View Details
Human GALE Protein, His Tag
KMPH6437-02 100 µg

Human GALE Protein, His Tag

Ask
View Details
SLC6A20 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44258151 3x 1.0 µg DNA

SLC6A20 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
SORBS1 Recombinant Protein Antigen
NBP1-86641PEP 0.1 mL

SORBS1 Recombinant Protein Antigen

Ask
View Details
Anti-Human TMEM219 Antibody (SAA1858)
RHN02301 100 μg

Anti-Human TMEM219 Antibody (SAA1858)

Ask
View Details