Recombinant Mouse Epidermal Growth Factor/EGF (C-6His)
Source: E. coli. MW :7.2kD. Recombinant Mouse epidermal growth factor is produced by our E.coli expression system and the target gene encoding Asn977-Arg1029 is expressed with a 6His tag at the C-terminus. EGF is a single-pass type I membrane protein, containing 8 LDL-receptor class B repeats and 9 EGF-like domains. EGF results in cellular proliferation, differentiation, and survival.EGF is a low-molecular-weight polypeptide first purified from the mouse submandibular gland, but since then found in many human tissues including submandibular gland, parotid gland. Salivary EGF, which seems also regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents.
Product Specifications
Gene Name
Egf
Gene ID
13645
UniProt
P01132
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRLEHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items