Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epidermal Growth Factor/EGF (C-6His)

Source: E. coli. MW :7.2kD. Recombinant Mouse epidermal growth factor is produced by our E.coli expression system and the target gene encoding Asn977-Arg1029 is expressed with a 6His tag at the C-terminus. EGF is a single-pass type I membrane protein, containing 8 LDL-receptor class B repeats and 9 EGF-like domains. EGF results in cellular proliferation, differentiation, and survival.EGF is a low-molecular-weight polypeptide first purified from the mouse submandibular gland, but since then found in many human tissues including submandibular gland, parotid gland. Salivary EGF, which seems also regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents.

Product Specifications

Gene Name

Egf

Gene ID

13645

UniProt

P01132

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HSP90AA1 Antibody
E30AC313 100 µL

HSP90AA1 Antibody

Ask
View Details
CHML (Rab Proteins Geranylgeranyltransferase Component A 2, Choroideraemia-like Protein, Rab Escort Protein 2, REP-2, REP2)
124953 100 µg

CHML (Rab Proteins Geranylgeranyltransferase Component A 2, Choroideraemia-like Protein, Rab Escort Protein 2, REP-2, REP2)

Ask
View Details
PANK2 (NM_024960) Human Untagged Clone
SC111841 10 µg

PANK2 (NM_024960) Human Untagged Clone

Ask
View Details