Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epidermal Growth Factor/EGF (C-6His)

Source: E. coli. MW :7.2kD. Recombinant Mouse epidermal growth factor is produced by our E.coli expression system and the target gene encoding Asn977-Arg1029 is expressed with a 6His tag at the C-terminus. EGF is a single-pass type I membrane protein, containing 8 LDL-receptor class B repeats and 9 EGF-like domains. EGF results in cellular proliferation, differentiation, and survival.EGF is a low-molecular-weight polypeptide first purified from the mouse submandibular gland, but since then found in many human tissues including submandibular gland, parotid gland. Salivary EGF, which seems also regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents.

Product Specifications

Gene Name

Egf

Gene ID

13645

UniProt

P01132

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynactin Subunit 2 (DCTN2) Antibody
abx332547 100 µL

Dynactin Subunit 2 (DCTN2) Antibody

Sign In for Pricing
View Details
ERAS Antibody
E51A00550 100 µL

ERAS Antibody

Sign In for Pricing
View Details
InhA Antibody (FITC)
orb243560-01 50 µg

InhA Antibody (FITC)

Sign In for Pricing
View Details
InhA Antibody (FITC)
orb243560-02 100 µg

InhA Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Sigma factor-binding protein crl (crl)
MBS1325663-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Sigma factor-binding protein crl (crl)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Sigma factor-binding protein crl (crl)
MBS1325663-02 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Sigma factor-binding protein crl (crl)

Sign In for Pricing
View Details