Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Migration Inhibitory Factor/MIF (C-6His)

Source: E. coli. MW :13.5kD. Recombinant Mouse Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Pro2-Ala115 is expressed with a 6His tag at the C-terminus. Macrophage migration inhibitory factor (MIF) is a secreted protein and belongs to the MIF family. MIF is an important regulator of innate immunity. The circulating MIF binds to CD74 on other immune cells to trigger an acute immune response. Hence MIF is classified as an inflammatory cytokine. Furthermore glucocorticoids also stimulate white blood cells to release MIF and hence MIF partially counter acts the inhibitory effects that glucocorticoids have on the immune system. Finally trauma activates the anterior pituitary gland to release MIF.

Product Specifications

Gene Name

Mif

Gene ID

17319

UniProt

P34884

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RG228834 10 µg

P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone

Ask
View Details
DSTYK Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-7597R-APC-Cy5.5 100 µL

DSTYK Polyclonal Antibody, APC-Cy5.5 Conjugated

Ask
View Details
ADP (Adiponectin) BioAssayTM ELISA Kit (Human) discontinued
353742-01 48 Tests

ADP (Adiponectin) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
ADP (Adiponectin) BioAssayTM ELISA Kit (Human) discontinued
353742-02 96 Tests

ADP (Adiponectin) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
Anti-SARS CoV2 Spike RBD Antibody (Clone: ABM2A3.1D12)
10-10036-100 100 µg

Anti-SARS CoV2 Spike RBD Antibody (Clone: ABM2A3.1D12)

Ask
View Details
Rabbit anti-human N-alpha-acetyltransferase 10 polyclonal Antibody(NAA10)
MBS1498475-01 0.05 mL

Rabbit anti-human N-alpha-acetyltransferase 10 polyclonal Antibody(NAA10)

Ask
View Details