Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Migration Inhibitory Factor/MIF (C-6His)

Source: E. coli. MW :13.5kD. Recombinant Mouse Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Pro2-Ala115 is expressed with a 6His tag at the C-terminus. Macrophage migration inhibitory factor (MIF) is a secreted protein and belongs to the MIF family. MIF is an important regulator of innate immunity. The circulating MIF binds to CD74 on other immune cells to trigger an acute immune response. Hence MIF is classified as an inflammatory cytokine. Furthermore glucocorticoids also stimulate white blood cells to release MIF and hence MIF partially counter acts the inhibitory effects that glucocorticoids have on the immune system. Finally trauma activates the anterior pituitary gland to release MIF.

Product Specifications

Gene Name

Mif

Gene ID

17319

UniProt

P34884

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLACE Recombinant Protein Antigen
NBP1-90970PEP 0.1 mL

BLACE Recombinant Protein Antigen

Sign In for Pricing
View Details
Interleukin 6 (IL-6) BioAssayTM ELISA Kit (Equine)
026264 96 Tests

Interleukin 6 (IL-6) BioAssayTM ELISA Kit (Equine)

Sign In for Pricing
View Details
WDR90 ORF Vector (Human) (pORF)
ORF011585 1.0 µg DNA

WDR90 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
(-)-MDO-NPA HCl
MBS5778899 Inquire

(-)-MDO-NPA HCl

Sign In for Pricing
View Details
Cytokeratin 8 Mouse Monoclonal Antibody (Cy7)
orb1082231 100 µL

Cytokeratin 8 Mouse Monoclonal Antibody (Cy7)

Sign In for Pricing
View Details
STAT1 Antibody (8H11)
N1589-01 40 µL

STAT1 Antibody (8H11)

Sign In for Pricing
View Details