Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13/IL-13 (Ser26-Phe131)

Source: E. coli. MW :11.7kD. Recombinant Mouse Interleukin-13 is produced by our E.coli expression system and the target gene encoding Ser26-Phe131 is expressed. Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Ra1 with low affinity and triggers association of IL4Ra, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Ra2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.

Product Specifications

Gene Name

Il13

Gene ID

16163

UniProt

P20109

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse anti Human IgA2 (subclass specific), conjugated with Horseradish peroxidase
MBS571032-01 0.2 mg

Mouse anti Human IgA2 (subclass specific), conjugated with Horseradish peroxidase

Ask
View Details
Mouse anti Human IgA2 (subclass specific), conjugated with Horseradish peroxidase
MBS571032-02 5x 0.2 mg

Mouse anti Human IgA2 (subclass specific), conjugated with Horseradish peroxidase

Ask
View Details
10-Hydroperoxy-norethisterone Enantate
TRC-H401440-2.5MG 2.5 mg

10-Hydroperoxy-norethisterone Enantate

Ask
View Details
Rftn1 AAV siRNA Pooled Vector
38873164 1.0 µg

Rftn1 AAV siRNA Pooled Vector

Ask
View Details
SGLT2-IN-1 (Standard)
HY-I1120R 1 Each

SGLT2-IN-1 (Standard)

Ask
View Details
C8orf33 Polyclonal Antibody
MBS9235495-01 0.1 mL

C8orf33 Polyclonal Antibody

Ask
View Details