Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hepcidin/HAMP (N-GST)

Source: E. coli. MW :2.92kD. Recombinant Human Hepcidin is produced by our E.coli expression system and the target gene encoding Asp60-Thr84 is expressed with a GST tag at the N-terminus. Hepcidin (HAMP) is a secreted protein that belongs to the hepcidin family.It is expressed in liver, heart and brain. It is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta sheet structures.

Product Specifications

Gene Name

HAMP

Gene ID

57817

UniProt

P81172

Components

Supplied as a 0.2 μm filtered solution of PBS,50%glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCGMCCKT
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

4,4,4-Trifluoro-1-(4-fluorophenyl)butane-1,3-dione
TRC-T787100-1G 1 g

4,4,4-Trifluoro-1-(4-fluorophenyl)butane-1,3-dione

Ask
View Details
Charged multivesicular body protein 1a (CHMP1A) Human ELISA Kit
C3182 96 Tests

Charged multivesicular body protein 1a (CHMP1A) Human ELISA Kit

Ask
View Details
2000 mL Glass collection bottle
11251004 1 Set

2000 mL Glass collection bottle

Ask
View Details
Gpr65 (NM_008152) Mouse Tagged ORF Clone Lentiviral Particle
MR205027L4V 200 µL

Gpr65 (NM_008152) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Parvin alpha (PARVA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G10]
TA506025BM 100 µL

Parvin alpha (PARVA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G10]

Ask
View Details