Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear Transcription Factor Y Subunit a/NFYA

Source: E. coli. MW :33.9kD. Recombinant Human Nuclear TF Y subunit alpha is produced by our E.coli expression system and the target gene encoding Met1-Ser318 is expressed. Nuclear Transcription Factor Y Subunit a (NFYA) is a member of the NFYA/HAP2 subunit family. NFYA founctions as a heterotrimeric transcription factor , which is composed of three components, NF-YA, NF-YB and NF-YC, binds to CCAAT motifs in the promoter regions in a variety of genes. NFYA forms a highly conserved transcription factor which stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.

Product Specifications

Gene Name

NFYA

Gene ID

4800

UniProt

P23511

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaV1.2 Antibody
MBS801132-01 0.1 mg

CaV1.2 Antibody

Sign In for Pricing
View Details
CaV1.2 Antibody
MBS801132-02 5x 0.1 mg

CaV1.2 Antibody

Sign In for Pricing
View Details
Ccr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6921208 1.0 µg DNA

Ccr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal human WASP Antibody
orb1409507-01 100 µg

Mouse Monoclonal human WASP Antibody

Sign In for Pricing
View Details
Mouse Monoclonal human WASP Antibody
orb1409507-02 50 µg

Mouse Monoclonal human WASP Antibody

Sign In for Pricing
View Details
Mouse Hepatocyte growth factor receptor (MET) ELISA kit
GTR10429262 96 Well

Mouse Hepatocyte growth factor receptor (MET) ELISA kit

Sign In for Pricing
View Details