Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear Transcription Factor Y Subunit a/NFYA

Source: E. coli. MW :33.9kD. Recombinant Human Nuclear TF Y subunit alpha is produced by our E.coli expression system and the target gene encoding Met1-Ser318 is expressed. Nuclear Transcription Factor Y Subunit a (NFYA) is a member of the NFYA/HAP2 subunit family. NFYA founctions as a heterotrimeric transcription factor , which is composed of three components, NF-YA, NF-YB and NF-YC, binds to CCAAT motifs in the promoter regions in a variety of genes. NFYA forms a highly conserved transcription factor which stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.

Product Specifications

Gene Name

NFYA

Gene ID

4800

UniProt

P23511

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB2 Rabbit Polyclonal Antibody (Biotin)
orb459199 100 µL

ZBTB2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MB Mouse Monoclonal Antibody
AMM82359-01 1 Each

MB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MB Mouse Monoclonal Antibody
AMM82359-02 50 µL

MB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MB Mouse Monoclonal Antibody
AMM82359-03 100 µL

MB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ISOC2 Knockout NCI-H1975 Polyclonal Cells
ARG31763 1 Million

ISOC2 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Mouse Mrpl11 Pre-designed siRNA Set A
SI108684A 1 Each

Mouse Mrpl11 Pre-designed siRNA Set A

Sign In for Pricing
View Details