Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A
Source: E. coli. MW :11.6kD. Recombinant Human SUMO3 is produced by our E.coli expression system and the target gene encoding Met1-Phe103 is expressed. SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.
Product Specifications
Gene Name
SUMO3
Gene ID
6612
UniProt
P55854
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items