Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A

Source: E. coli. MW :11.6kD. Recombinant Human SUMO3 is produced by our E.coli expression system and the target gene encoding Met1-Phe103 is expressed. SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.

Product Specifications

Gene Name

SUMO3

Gene ID

6612

UniProt

P55854

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Human CD18 Monoclonal Antibody (PE Conjugated)
MBS2556483-01 20 Tests

Anti-Human CD18 Monoclonal Antibody (PE Conjugated)

Ask
View Details
Anti-Human CD18 Monoclonal Antibody (PE Conjugated)
MBS2556483-02 100 Tests

Anti-Human CD18 Monoclonal Antibody (PE Conjugated)

Ask
View Details
Anti-Human CD18 Monoclonal Antibody (PE Conjugated)
MBS2556483-03 2x 100 Tests

Anti-Human CD18 Monoclonal Antibody (PE Conjugated)

Ask
View Details
Anti-Human CD18 Monoclonal Antibody (PE Conjugated)
MBS2556483-04 10x 100 Tests

Anti-Human CD18 Monoclonal Antibody (PE Conjugated)

Ask
View Details
Recombinant Kallikrein 8 (KLK8)
SIPA854Mu01-01 10 µg

Recombinant Kallikrein 8 (KLK8)

Ask
View Details
Recombinant Kallikrein 8 (KLK8)
SIPA854Mu01-02 50 µg

Recombinant Kallikrein 8 (KLK8)

Ask
View Details