Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cardiotrophin-1/CTF1 (N-6His)

Source: E. coli. MW :22.6kD. Recombinant Human Cardiotrophin-1 is produced by our E.coli expression system and the target gene encoding Met1-Ala201 is expressed with a 6His tag at the N-terminus. Cardiotrophin-1, also known as CT-1 and CTF1, is a member of the IL-6 superfamily. It is a sreted cytokine that is expressed in heart, skeletal muscle, prostate and ovary, and to lower levels in lung, kidney, pancreas, thymus, testis and small intestine. The protein exerts its cellular effects by interacting with the glycoprotein 130 (gp130) /leukemia inhibitory factor receptor beta (LIFR) heterodimer. In addition, CT-1 activates phosphatidylinositol 3-kinase (PI-3 kinase) in cardiac myocytes and enhances transcription factor NF-kB DNA -binding activities.

Product Specifications

Gene Name

CTF1

Gene ID

1489

UniProt

Q16619

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Outer dense fiber protein 3, ODF3 ELISA Kit
MBS9335896-01 48 Well

Bovine Outer dense fiber protein 3, ODF3 ELISA Kit

Sign In for Pricing
View Details
Bovine Outer dense fiber protein 3, ODF3 ELISA Kit
MBS9335896-02 96 Well

Bovine Outer dense fiber protein 3, ODF3 ELISA Kit

Sign In for Pricing
View Details
Bovine Outer dense fiber protein 3, ODF3 ELISA Kit
MBS9335896-03 5x 96 Well

Bovine Outer dense fiber protein 3, ODF3 ELISA Kit

Sign In for Pricing
View Details
Bovine Outer dense fiber protein 3, ODF3 ELISA Kit
MBS9335896-04 10x 96 Well

Bovine Outer dense fiber protein 3, ODF3 ELISA Kit

Sign In for Pricing
View Details
Lrdd sgRNA CRISPR Lentivector set (Mouse)
K4477901 3x 1.0 µg

Lrdd sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
LGMN (Legumain, AEP, LGMN1, PRSC1, Protease, Cysteine 1, Asparaginyl endopeptidase)
363960 200 µL

LGMN (Legumain, AEP, LGMN1, PRSC1, Protease, Cysteine 1, Asparaginyl endopeptidase)

Sign In for Pricing
View Details