Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 4-1BB Ligand/4-1BBL/TNFSF9/CD137L (C-6His)

Source: E. coli. MW :20.6kD. Recombinant Human 4-1BB ligand is produced by our E.coli expression system and the target gene encoding Arg71-Glu254 is expressed with a 6His tag at the C-terminus. Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumor necrosis factor family. It is a 254 amino acids cytokine that is expressed in brain, placenta, lung, skeletal muscle and kidney. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells, and is thought to be involved in T cell-tumor cell interaction.

Product Specifications

Gene Name

TNFSF9

Gene ID

8744

UniProt

P41273

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSELEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF594 conjugate, 0.1mg/mL
BNC941497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL
BNC402278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684), CF405S conjugate, 0.1mg/mL
BNC040684-100 1x 100 µL

CD68 (C68/684), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF405S conjugate, 0.1mg/mL
BNC041810-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details