Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B/MAP1LC3B

Source: E.coli. MW :14.8kD. Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B is produced by our E.coli expression system and the target gene encoding Met1-Val125 is expressed. Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) is a member of the highly conserved ATG8 protein family. ATG8 proteins are present in all known eukaryotic organisms. MAP1LC3B is one of the four genes in the MAP1LC3 subfamily (others include MAP1LC3A, MAP1LC3C, and MAP1LC3B2) . It is moat abundantly expressed in heart, brain, skeletal muscle and testis. LMAP1LC3B is a subunit of neuronal microtubule and functions in formation of autophagosomal vacuoles (autophagosomes) . It associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. MAP1LC3B also plays a role in autophagy, a process that involves the bulk degradation of cytoplasmic component.

Product Specifications

Gene Name

MAP1LC3B

Gene ID

81631

UniProt

Q9GZQ8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 2mM DTT, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

More Discoveries

Explore Other Products

Browse additional items from our catalog

UFM1 (NM_001286704) Human Untagged Clone
SC333511 10 µg

UFM1 (NM_001286704) Human Untagged Clone

Sign In for Pricing
View Details
ACO1 (FITC)
554244-01 50 µg

ACO1 (FITC)

Sign In for Pricing
View Details
ACO1 (FITC)
554244-02 100 µg

ACO1 (FITC)

Sign In for Pricing
View Details
Hyaluronan Synthase 2 (HAS2) Antibody
abx405778-01 100 µL

Hyaluronan Synthase 2 (HAS2) Antibody

Sign In for Pricing
View Details
Hyaluronan Synthase 2 (HAS2) Antibody
abx405778-02 200 µL

Hyaluronan Synthase 2 (HAS2) Antibody

Sign In for Pricing
View Details
Hyaluronan Synthase 2 (HAS2) Antibody
abx405778-03 1 mL

Hyaluronan Synthase 2 (HAS2) Antibody

Sign In for Pricing
View Details