Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B/MAP1LC3B
Source: E.coli. MW :14.8kD. Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B is produced by our E.coli expression system and the target gene encoding Met1-Val125 is expressed. Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) is a member of the highly conserved ATG8 protein family. ATG8 proteins are present in all known eukaryotic organisms. MAP1LC3B is one of the four genes in the MAP1LC3 subfamily (others include MAP1LC3A, MAP1LC3C, and MAP1LC3B2) . It is moat abundantly expressed in heart, brain, skeletal muscle and testis. LMAP1LC3B is a subunit of neuronal microtubule and functions in formation of autophagosomal vacuoles (autophagosomes) . It associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. MAP1LC3B also plays a role in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Product Specifications
Gene Name
MAP1LC3B
Gene ID
81631
UniProt
Q9GZQ8
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 2mM DTT, pH8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Explore Other Products
Browse additional items from our catalog