Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B/MAP1LC3B

Source: E.coli. MW :14.8kD. Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B is produced by our E.coli expression system and the target gene encoding Met1-Val125 is expressed. Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) is a member of the highly conserved ATG8 protein family. ATG8 proteins are present in all known eukaryotic organisms. MAP1LC3B is one of the four genes in the MAP1LC3 subfamily (others include MAP1LC3A, MAP1LC3C, and MAP1LC3B2) . It is moat abundantly expressed in heart, brain, skeletal muscle and testis. LMAP1LC3B is a subunit of neuronal microtubule and functions in formation of autophagosomal vacuoles (autophagosomes) . It associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. MAP1LC3B also plays a role in autophagy, a process that involves the bulk degradation of cytoplasmic component.

Product Specifications

Gene Name

MAP1LC3B

Gene ID

81631

UniProt

Q9GZQ8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 2mM DTT, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MGMT (O6-Methylguanine DNA Methyltransferase) (MaxLight 490)
M3884-92C-ML490 100 µL

MGMT (O6-Methylguanine DNA Methyltransferase) (MaxLight 490)

Ask
View Details
Rabbit Polyclonal ENTHD2 Antibody
NBP3-24817 100 µL

Rabbit Polyclonal ENTHD2 Antibody

Ask
View Details
FXYD3 Overexpression Lysate (Native) - (Dry Ice)
NBP2-07685 0.1 mg

FXYD3 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-01 0.1 mL (Biotin)

KAT6B Polyclonal Conjugated Antibody

Ask
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-02 0.1 mL (AF350)

KAT6B Polyclonal Conjugated Antibody

Ask
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-03 0.1 mL (AF405)

KAT6B Polyclonal Conjugated Antibody

Ask
View Details