Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor Necrosis Factor a/TNFa (C-6His)

Source: E. coli. MW :18.5kD. Recombinant Human Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Val77-Leu233 is expressed with a 6His tag at the C-terminus. Tumor Necrosis Factor-a (TNF-a) is secreted by macrophages, monocytes, neutrophils, T-cells, and NK-cells following stimulation by bacterial LPS. Cells expressing CD4 secrete TNF-a while cells that express CD8 secrete little or no TNF-a. Synthesis of TNF-a can be induced by many different stimuli including interferons, IL2, and GM-CSF. The clinical use of the potent anti-tumor activity of TNF-a has been limited by the proinflammatory side effects such as fever, dose-limiting hypotension, hepatotoxicity, intravascular thrombosis, and hemorrhage. Designing clinically applicable TNF-a mutants with low systemic toxicity has been of intense pharmacological interest. Human TNF-a that binds to murine TNF-R55 but not murine TNF-R7, exhibits retained anti-tumor activity and reduced systemic toxicity in mice compared with murine TNF-a, which binds to both murine TNF receptors. Based on these results, many TNF-a mutants that selectively bind to TNF-R55 have been designed. These mutants displayed cytotoxic activities on tumor cell lines in vitro and have exhibited lower systemic toxicity in vivo. Recombinant Human TNF-a High Active Mutant differs from the wild-type by amino acid subsitution of amino acids 1-7 with Arg8, Lys9, Arg10 and Phe157. This mutant form has been shown to have increased activity with less inflammatory side effects in vivo.

Product Specifications

Gene Name

TNF

Gene ID

7124

UniProt

P01375

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 Rabbit Polyclonal Antibody
ER1706-35 100 µL

CD71 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Amino-2-mercaptobenzimidazole
TRC-A576965-5G 5 g

5-Amino-2-mercaptobenzimidazole

Sign In for Pricing
View Details
PARD3 Human Gene Knockout Kit (CRISPR)
KN423698 1 Kit

PARD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody
AP20909PU-N 100 µg

VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific,  40nm
GAF-512-40 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific, 40nm

Sign In for Pricing
View Details
Recombinant Tat SF1 Antibody
RC-16275-01 50 μL

Recombinant Tat SF1 Antibody

Sign In for Pricing
View Details