Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1/ARG1 (C-6His)

Source: E. coli. MW :35.8kD. Recombinant Human Arginase-1 is produced by our E.coli expression system and the target gene encoding Met1-lys322 is expressed with a 6His tag at the C-terminus. ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.

Product Specifications

Gene Name

ARG1

Gene ID

383

UniProt

P05089

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 20% Glycerol, 1mM DTT, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF640R conjugate, 0.1mg/mL
BNC401170-500 1x 500 µL

Vimentin (VM1170), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details