Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1/ARG1 (C-6His)

Source: E. coli. MW :35.8kD. Recombinant Human Arginase-1 is produced by our E.coli expression system and the target gene encoding Met1-lys322 is expressed with a 6His tag at the C-terminus. ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.

Product Specifications

Gene Name

ARG1

Gene ID

383

UniProt

P05089

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 20% Glycerol, 1mM DTT, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128194-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128194-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128194-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128194-04 1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128194-05 5 mL

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128194-06 5x 5 mL

Cy3 Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details