Recombinant Human Unique Cartilage Matrix-Associated Protein/UCMA
Source: E. coli. MW :9.76kD. Recombinant Human Unique cartilage matrix-associated protein is produced by our E.coli expression system and the target gene encoding Ser65-Thr138 is expressed. C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
Product Specifications
Gene Name
UCMA
Gene ID
221044
UniProt
Q8WVF2
Components
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items