Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unique Cartilage Matrix-Associated Protein/UCMA

Source: E. coli. MW :9.76kD. Recombinant Human Unique cartilage matrix-associated protein is produced by our E.coli expression system and the target gene encoding Ser65-Thr138 is expressed. C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.

Product Specifications

Gene Name

UCMA

Gene ID

221044

UniProt

Q8WVF2

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit
CK-bio-13186-01 48 Tests

Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit

Ask
View Details
Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit
CK-bio-13186-02 96 Tests

Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit

Ask
View Details
Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit
CK-bio-13186-03 5x 96 Tests

Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit

Ask
View Details
Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit
CK-bio-13186-04 10x 96 Tests

Human Regenerating islet-derived protein 3-alpha, REG-3-alpha ELISA Kit

Ask
View Details
Human Gemin 2 (GEMIN2) activation kit by CRISPRa
GA105608 1 Kit

Human Gemin 2 (GEMIN2) activation kit by CRISPRa

Ask
View Details
Lentiviral human G2E3 shRNA (UAS) - Lentiviral human G2E3 shRNA (UAS, GFP) (25)
GTR15147584 1 Vial

Lentiviral human G2E3 shRNA (UAS) - Lentiviral human G2E3 shRNA (UAS, GFP) (25)

Ask
View Details