Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unique Cartilage Matrix-Associated Protein/UCMA

Source: E. coli. MW :9.76kD. Recombinant Human Unique cartilage matrix-associated protein is produced by our E.coli expression system and the target gene encoding Ser65-Thr138 is expressed. C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.

Product Specifications

Gene Name

UCMA

Gene ID

221044

UniProt

Q8WVF2

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Microfibrillar Associated Protein 2 (MFAP2) Antibody
abx028706-01 80 µL

Microfibrillar Associated Protein 2 (MFAP2) Antibody

Ask
View Details
Microfibrillar Associated Protein 2 (MFAP2) Antibody
abx028706-02 400 µL

Microfibrillar Associated Protein 2 (MFAP2) Antibody

Ask
View Details
Mouse RBM44 shRNA Plasmid
abx983548-01 150 µg

Mouse RBM44 shRNA Plasmid

Ask
View Details
Mouse RBM44 shRNA Plasmid
abx983548-02 300 µg

Mouse RBM44 shRNA Plasmid

Ask
View Details
Rabbit Polyclonal GLUT9 Antibody [DyLight 488]
NBP1-05054G 0.1 mL

Rabbit Polyclonal GLUT9 Antibody [DyLight 488]

Ask
View Details
PASK/STK37 Rabbit pAb
E47R19896 100 µL

PASK/STK37 Rabbit pAb

Ask
View Details