Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Profilin-2/PFN2

Source: E. coli. MW :15kD. Recombinant Human Profilin-2 is produced by our E.coli expression system and the target gene encoding Met1-Phe140 is expressed. Profilin-II (PFN2) is ubiquitous protein which belongs to the profilin family. PFN2 binds to actin, thenaffects the structure of the cytoskeleton. At high concentrations, profiling prevents the polymerization of actin, while increases that at low concentrations. PFN2 is a ubiquitous actin monomer-binding protein. It regulates actin polymerization in response to extra cellular signals. PFN2 binds to PIP2; it inhibits the formation of IP3 and DG.

Product Specifications

Gene Name

PFN2

Gene ID

5217

UniProt

P35080

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-STING (Phospho-S366) Antibody
CPA6619-01 30 µL

Anti-STING (Phospho-S366) Antibody

Ask
View Details
Anti-STING (Phospho-S366) Antibody
CPA6619-02 50 μL

Anti-STING (Phospho-S366) Antibody

Ask
View Details
Anti-STING (Phospho-S366) Antibody
CPA6619-03 100 µL

Anti-STING (Phospho-S366) Antibody

Ask
View Details
Anti-STING (Phospho-S366) Antibody
CPA6619-04 200 µL

Anti-STING (Phospho-S366) Antibody

Ask
View Details
Complete MeWo Cell Medium with Serum and Supplements
C6573C 550 mL

Complete MeWo Cell Medium with Serum and Supplements

Ask
View Details
Beta-2-Microglobulin (B2M) Antibody
abx139056 0.1 mg

Beta-2-Microglobulin (B2M) Antibody

Ask
View Details