Recombinant Human Profilin-2/PFN2
Source: E. coli. MW :15kD. Recombinant Human Profilin-2 is produced by our E.coli expression system and the target gene encoding Met1-Phe140 is expressed. Profilin-II (PFN2) is ubiquitous protein which belongs to the profilin family. PFN2 binds to actin, thenaffects the structure of the cytoskeleton. At high concentrations, profiling prevents the polymerization of actin, while increases that at low concentrations. PFN2 is a ubiquitous actin monomer-binding protein. It regulates actin polymerization in response to extra cellular signals. PFN2 binds to PIP2; it inhibits the formation of IP3 and DG.
Product Specifications
Gene Name
PFN2
Gene ID
5217
UniProt
P35080
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items