Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 19/FGF-19 (N-6His)

Source: E. coli. MW :23.5kD. Recombinant Human Fibroblast growth factor 19 is produced by our E.coli expression system and the target gene encoding Phe27-Lys216 is expressed with a 6His tag at the N-terminus. Fibroblast growth factor 19 (FGF19) is a secreted protein which belongs to the FGFs family. FGF19 is expressed in fetal brain, cartilage, retina, and adult gall bladder. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs) : FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity. FGFRs can be important for regulation of glucose and lipid homeostasis. FGF19 has important roles as a hormone produced in the ileum in response to bile acid absorption. It has been shown to cause resistance to diet-induced obesity and insulin desensitization and to improve insulin, glucose, and lipid profiles in diabetic rodents. FGF19 can be considered as a regulator of energy expenditure.

Product Specifications

Gene Name

FGF19

Gene ID

9965

UniProt

O95750

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM45 Recombinant Protein (Mouse)
RP167210 100 µg

RBM45 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Polyclonal Antibody to Her3/ErbB3 (phospho-Tyr1328)
35-1307-100 100 µL

Polyclonal Antibody to Her3/ErbB3 (phospho-Tyr1328)

Sign In for Pricing
View Details
SMOC1 (NM_022137) Human Over-expression Lysate
LY411742 100 µg

SMOC1 (NM_022137) Human Over-expression Lysate

Sign In for Pricing
View Details
Kv1.8 (KCNA10) (NM_005549) Human Over-expression Lysate
LY401703 100 µg

Kv1.8 (KCNA10) (NM_005549) Human Over-expression Lysate

Sign In for Pricing
View Details
IL17RA Polyclonal Antibody
RD70354A-01 60 μL

IL17RA Polyclonal Antibody

Sign In for Pricing
View Details
IL17RA Polyclonal Antibody
RD70354A-02 120 μL

IL17RA Polyclonal Antibody

Sign In for Pricing
View Details