Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uracil Phosphoribosyltransferase Homolog/UPRT (N-6His)

Source: E. coli. MW :35.9kD. Recombinant Human UPRT is produced by our E.coli expression system and the target gene encoding Met1-Asp309 is expressed with a 6His tag at the N-terminus. UPRT is a cytoplasmic enzyme which belongs to the UPRTase family. UPRT is highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle. UPRTcatalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP) . This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. UPRT is a potential target for rational design of drugs to treat parasitic infections and cancer

Product Specifications

Gene Name

UPRT

Gene ID

139596

UniProt

Q96BW1

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTHFGQKYFGTD
More Discoveries

Explore Other Products

Browse additional items from our catalog

Allc sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4064604 1.0 µg DNA

Allc sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human ZWILCH shRNA (UAS) - Lentiviral human ZWILCH shRNA (UAS) (100)
GTR15335637 1 Vial

Lentiviral human ZWILCH shRNA (UAS) - Lentiviral human ZWILCH shRNA (UAS) (100)

Sign In for Pricing
View Details
Mpz Rat shRNA Plasmid (Locus ID 24564)
TL709843 1 Kit

Mpz Rat shRNA Plasmid (Locus ID 24564)

Sign In for Pricing
View Details
IDH2 Rabbit mAb
MBS4761646-01 0.1 mL

IDH2 Rabbit mAb

Sign In for Pricing
View Details
IDH2 Rabbit mAb
MBS4761646-02 5x 0.1 mL

IDH2 Rabbit mAb

Sign In for Pricing
View Details
CHRFAM7A Rabbit Polyclonal Antibody
TA321939 100 µL

CHRFAM7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details