Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uracil Phosphoribosyltransferase Homolog/UPRT (N-6His)

Source: E. coli. MW :35.9kD. Recombinant Human UPRT is produced by our E.coli expression system and the target gene encoding Met1-Asp309 is expressed with a 6His tag at the N-terminus. UPRT is a cytoplasmic enzyme which belongs to the UPRTase family. UPRT is highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle. UPRTcatalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP) . This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. UPRT is a potential target for rational design of drugs to treat parasitic infections and cancer

Product Specifications

Gene Name

UPRT

Gene ID

139596

UniProt

Q96BW1

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTHFGQKYFGTD
More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued
210644-01 20 µL

EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued

Sign In for Pricing
View Details
EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued
210644-02 100 µL

EIF3M (Eukaryotic Translation Initiation Factor 3 Subunit M, B5, GA17, PCID1, TANGO7, hfl-B5) discontinued

Sign In for Pricing
View Details
Mouse Anti-Rat IgG1-BIOT
3061-08 0.5 mg

Mouse Anti-Rat IgG1-BIOT

Sign In for Pricing
View Details
Atipamezole 5mg
A21363-5 5 mg

Atipamezole 5mg

Sign In for Pricing
View Details
Olfr5 Double Nickase Plasmid (m)
sc-422040-NIC 20 µg

Olfr5 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
STK10 Antibody
A14548-50UG 50 µg

STK10 Antibody

Sign In for Pricing
View Details